PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC032126.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family B3
Protein Properties Length: 267aa    MW: 30455.8 Da    PI: 9.4379
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC032126.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.61.5e-15331252100
                   EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
            B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                   fk+   s++l+sg l +pk+f++++g++   s  + l+ + g  W+++l  +k+ +  + l kGW+eF +   +  g  +vFk++g+s+f  +v +f
  EcC032126.30  33 FKII-LSNALESGKLGIPKNFLRRCGKD--LSNSVLLKVPGGSAWTIEL--EKCTNDlVSLWKGWQEFMEHYSIGLGHLIVFKYKGNSTF--HVIIF 122
                   4444.589999999***********977..8889***************..9999998999*************************9999..**999 PP

                   -SS CS
            B3  98 rks 100
                   +ks
  EcC032126.30 123 DKS 125
                   985 PP

2B346.75.8e-151802581899
                   --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
            B3  18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   +p  fa+++ ++   ++++     s  sW vkl  + ++ +  +++GW  F+++n L++gD+++F+l++r++  + v+++r+
  EcC032126.30 180 IPVGFARQYIQE---NREMATLRYSDGSWLVKLLRTLRDHQACFSAGWTAFARENCLRVGDVCMFELIDRDDVVFQVSICRS 258
                   99****999433...235666667889******7777777799*************************9999999****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-2229125IPR015300DNA-binding pseudobarrel domain
CDDcd100177.18E-1830123No hitNo description
Gene3DG3DSA:2.40.330.101.6E-2130125IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.49331125IPR003340B3 DNA binding domain
SMARTSM010195.6E-1432125IPR003340B3 DNA binding domain
PfamPF023625.0E-1333124IPR003340B3 DNA binding domain
SMARTSM010194.8E-7176259IPR003340B3 DNA binding domain
SuperFamilySSF1019361.75E-15177258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.9E-17177258IPR015300DNA-binding pseudobarrel domain
PfamPF023627.4E-12180258IPR003340B3 DNA binding domain
CDDcd100171.00E-15180257No hitNo description
PROSITE profilePS5086311.223180259IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MASRNGRRRR RREDGAVERE VATGPRLGSR CFFKIILSNA LESGKLGIPK NFLRRCGKDL  60
SNSVLLKVPG GSAWTIELEK CTNDLVSLWK GWQEFMEHYS IGLGHLIVFK YKGNSTFHVI  120
IFDKSASEID YSSSSSKILY PGSKLPSPKS EDFLGAEDLQ DSRPRRRMRI EPHLPYSQNI  180
PVGFARQYIQ ENREMATLRY SDGSWLVKLL RTLRDHQACF SAGWTAFARE NCLRVGDVCM  240
FELIDRDDVV FQVSICRSAG TDRIHID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311RNGRRRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010068368.11e-140PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A059BCJ91e-107A0A059BCJ9_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-19B3 family protein